PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00068.1.g00060.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 618aa    MW: 67261.3 Da    PI: 9.3295
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00068.1.g00060.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP73.14.9e-23329377149
                                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
                           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 
                                   +Cq+egC+adls ak+yhrrhkvCe h+ka+vv++ g++qrfCqqCsr 
  Zjn_sc00068.1.g00060.1.am.mk 329 RCQAEGCKADLSGAKHYHRRHKVCEYHAKASVVTAGGKQQRFCQQCSRV 377
                                   6**********************************************96 PP

2SBP47.16.2e-154294604677
                                   TSSEEETTT--SS--S-STTTT-------S-- CS
                           SBP  46 CsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                                      fh l+efDe+krsCr+rLa+hn+rrrk++
  Zjn_sc00068.1.g00060.1.am.mk 429 FPEFHVLTEFDEAKRSCRKRLAEHNRRRRKPA 460
                                   568***************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.4E-25322377IPR004333Transcription factor, SBP-box
PROSITE profilePS5114121.341327459IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.62E-22328393IPR004333Transcription factor, SBP-box
PfamPF031103.4E-17330377IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-11422462IPR004333Transcription factor, SBP-box
PfamPF031108.3E-8431458IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 618 aa     Download sequence    Send to blast
MRMNMERLYT KEARRRALLS CSRVTDVPSR QLRLRPSTHT IRSSPAAAAC ISATSDRALF  60
QPHVHRLRHH SMAPPCRGNK QRCRSPAVVF RSFPSTSGYR DDRGSCREIE RAMHDSRDSS  120
ARSLPFSCSS LTSVHHHHTL APQLLITGCR TIDRPAMMSG RMNAVTSADG DDFPFAPSMQ  180
PPPPPYVGFD HGVAGGGMGA QRAGGMPHHL YDGLDFAAAA AMQFQEAPHH HQLLTLPSSL  240
AAPMAPPPPV PMSLQMPMPG LHGDVYPALG MVKREGGGGA EGGRIGLNLG RRTYFSPGDM  300
LAVDRLLMRS RLGGVFGLGF GGAHHQPPRC QAEGCKADLS GAKHYHRRHK VCEYHAKASV  360
VTAGGKQQRF CQQCSRVGSR GDMLLVRVPC LSWVVAMAEG CGFLLLACRA QESNLTCTST  420
GASRWPCPFP EFHVLTEFDE AKRSCRKRLA EHNRRRRKPA TTAVSSKDGG EPTAKKPNTG  480
AITSSYATDN KNLMSTPKPT VSSNTSSMIS CLDQGKQARP TLTLGAAQVD MDHQQQQQQL  540
STTLQVQPSA DHQEQHFLTS LQVHHHYQNC SSNNNNILSC SSVCPSALPP AANGELSDQT  600
NNSNNGNGNM HLFEMDFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A2e-15330376652squamosa promoter-binding protein-like 12
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1441458KRSCRKRLAEHNRRRRKP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4478861e-117KF447886.1 Triticum aestivum squamosa promoter-binding-like protein 22 (SPL22) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965676.11e-153PREDICTED: squamosa promoter-binding-like protein 10
SwissprotA2YFT93e-77SPL10_ORYSI; Squamosa promoter-binding-like protein 10
SwissprotQ0DAE83e-77SPL10_ORYSJ; Squamosa promoter-binding-like protein 10
TrEMBLK3XXA11e-153K3XXA1_SETIT; Uncharacterized protein
STRINGSi006559m1e-153(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.11e-32squamosa promoter binding protein-like 8